U.S. Measles Surveillance Dashboard

US national surveillance overview

CDC national totals and annual confirmed cases among U.S. residents by state.

Download surveillance report (PDF)

Confirmed cases3,471

2026 to date

Hospitalizations301

9% of confirmed cases

Public U.S. sequences805

2026 collection year

National 2026 totals include cases among international visitors to the United States. Sources: CDC Measles Cases and Outbreaks and PathoPlexus public sequence records.

Annual confirmed cases by state

Use the year selector to compare CDC’s published 2024–2026 state totals. New York City and New York State are reported separately by CDC; the map combines them.

Calendar year

Show

01–2425–99100–499500+

Population denominators for rates are from U.S. Census Bureau Population Estimates Program, Vintage 2025 (July 1, 2025).

Measles cases in 2025 and 2026 are elevated over previous years

Confirmed cases by rash-onset week of the year; values are weekly, not cumulative.

Show

Years shown

Each point shows cases in one CDC reporting week. Weeks run Sunday through Saturday, and week 1 is the first reporting week with at least four days in the new year. Month labels show approximate positions within the reporting year. Learn more about CDC reporting weeks.

Measles cases have spread to all regions of the US over the past three years

Annual confirmed measles cases by reporting location, grouped into US Census regions. Select a region to see its state-level composition. The current year is year to date.

Genomic surveillance context

These charts summarize 3,781 publicly available U.S. measles virus sequence records from PathoPlexus. Public sequence data provide useful genomic surveillance context, but the available records are not a representative sample of measles transmission, and proportions of genotypes should be interpreted with caution.

US sequences over time by genotype

Monthly counts by collection date; latest 18 months with records.

Time period

Timeline date

Most common reported genotypes

D82,748

B3766

D4123

D977

H127

D512

D39

G37

US sequences with a reported genotype.

Top 10 submitting organizations

Submitting organizations reported in public U.S. measles sequence metadata.

Institution	Total	Sequences
	2,583
	1,068
	68
	24
	12
	10
	6
	3
	2
5 labs have 1 submission each at the top-10 cutoff.

Select an organization to view sequence counts by submitting authors.

Submitting authors

2,583 sequences from Centers for Disease Control and Prevention (CDC)

Submitting authors	Total
Guerra, J. P.	1,125
Rota, P.	934
Rota, P.; Anderson, R.	132
Rota, P.; Kim, G.	95
Masters, N. B.; Mathis, A. L.; Leung, J.; Raines, K.; Paul, P.; Stanley, S.; Weg, A.; Pieracci, E.; Gearhart, S.; Beck, A. S.; Jumabaeva, M.; Davis, T.; Hacker, J.; Bankamp, B.; Rota, P. A.; Sugerman, D. E.; Gastanuduy, P. A.	42
Rivailler, P.; Rota, P.	40
Rota, P.; Bankamp, B.; Anderson, R.; Kim, G.; de Almeida, M. E.	35
Rota, P. A.	31
Rota, P.; Vrdl, C.	24
Bankamp, B.; Liu, C.; Rivailler, P.; Bera, J.; Shrivastava, S.; Kirkness, E. F.; Bellini, W. J.; Rota, P. A.	17
Tian, Y.; Lowe, L.; Rota, J.; Rota, P.	16
Tian, Y.; Lowe, L.; Lopareva, E.; McNall, R.; Rota, J.; Rota, P.	15
Rota, P.; Klammer, K.	12
Guerra, J.	11
Tian, Y.; Luis, L.; Lopareva, E.; McNall, R.; Rota, J.; Rota, P.	8
Rota, P. A.; Lowe, L.; Tian, Y.	6
Rivailler, P.; Chiriboga, M.; Rota, P.	5
Rota, P.; Tavera, P.; Rey-Benito, G. J.	5
Tian, Y.; Luis, L.; Rota, J.; Rota, P.	5
Bankamp, B.; Lopareva, E. N.; Kremer, J. R.; Tian, Y.; Clemens, M. S.; Patel, R.; Fowlkes, A. L.; Kessler, J. R.; Muller, C. P.; Bellini, W. J.; Rota, P. A.; LaMonte-Fowlkes, A. C.	4
Rota, P.; Wadsworth, N.	4
Tian, Y.; Luis, L.; McNall, R.; Lopareva, E.; Rota, J.; Rota, P.	4
Rota, P.; Bryant, P.; St George, K.	3
Rota, P.; Wharton, A.	3
Bankamp, B.; Bellini, W. J.; Rota, P. A.	2
Rota, P.; Wadsworth Center, Lo. V. D.	2
Bankamp, B.; Kearney, S. P.; Liu, X.; Bellini, W. J.; Rota, P. A.	1
Rota, P.; Bryant, P.; St. George, K.	1
Rota, P.; Klemmer, K.	1

Submitting authors	Total
Sainsbury, R.	1,048
Young, E.; Sainsbury, R.	14
Young, E.	6

Submitting authors

68 sequences from California Department of Public Health, Viral and Rickettsial Disease Laboratory

Submitting authors	Total
Probert, W.; Espinosa, A.; Hacker, J.	62
Espinosa, A.; Hacker, J.; Magana, L. C.; Marine, R.; Ng, T. F.; Lopareva, E. N.; Bankamp, B.	5
Espinosa, A.; Hacker, J.; Magana, L. C.; Marine, R.; Ng, T. F. F.; Lopareva, E. N.; Bankamp, B.	1

Submitting authors

24 sequences from Washington State Department of Health Public Health Labs, Division of Disease Control and Statistics

Submitting authors	Total
Dykema, P.; Hanson, N.; Yang, Q.; Lucas, D.; Grimmet, S. Jr.; Johnson, J.; Waterman, K.	24

Submitting authors

12 sequences from Los Angeles County Public Health Laboratories

Submitting authors	Total
Garrigues, J. M.; Green, N. M.	7
Fox, E. B.; Garrigues, J. M.; Green, N. M.	3
Garrigues, J. M.; Fox, E. B.; Green, N. M.	2

Submitting authors

10 sequences from J. Craig Venter Institute

Submitting authors	Total
Kirkness, E. F.; Halpin, R.; Bera, J.; Fedorova, N.; Overton, L.; Stockwell, T.; Amedeo, P.; Bishop, B.; Chen, H.; Edworthy, P.; Gupta, N.; Katzel, D.; Li, K.; Schobel, S.; Shrivastava, S.; Thovarai, V.; Wang, S.; Bankamp, B.; Byrd, L.; Bellini, W.; Rota, P.	10

Submitting authors

6 sequences from Rice University, Civil & Environmental Engineering

Submitting authors	Total
Wu, J.; Kalvapalle, P. B.; Wang, M. X.; Nute, M.; Ensor, K.; Hopkins, L.; Treangen, T.; Stadler, L. B.	6

Submitting authors

3 sequences from Johns Hopkins School of Public Health, W. Harry Feinstone Department of Molecular Microbiology and Immunology

Submitting authors	Total
Riddell, M. A.; Moss, W. J.; Hauer, D.; Monze, M.; Griffin, D. E.; Ryon, J. J.; Cutts, F.	3

Submitting authors

2 sequences from Kessler J.R., Laboratoire National de Sante/CRP-Sante, Immunology, 20A rue Auguste Lumiere, L-1950

Submitting authors	Total
Kessler, J. R.; Kremer, J. R.; Muller, C. P.	2

Some organization entries are grouped when the metadata describe the same institution under departmental or naming variants. Use the “Grouped” label to see every reported entry included. Organization is otherwise based on the reported author affiliation, with the PathoPlexus submitting group used when an affiliation is unavailable. Counts describe public sequence records, not unique patients or cases.

US sequences by collection year and reported state

Sequence counts for the latest three collection years. State columns are sorted by their combined sequence count across these three years; filter by Census region.

YearTotalTXSCUTAZMNNMILNYCAWAORVACOOHKSMTMIFLIAGANDPANJTNINSDWIKYOKMDLAMOAKVTARCTIDNVNHNCDEDCHIMARIWVWY

202680529335463623930111336111

202515776461971278823801143241014342831302414111720151291211799365342121111

202424113602671414826145105134111322111

Hover a cell for its state, year, and sequence count. States with no dated public sequence metadata in these years are omitted.

Phylogenetic context

North American measles virus tree

Publicly available measles virus genomes sampled in North America are shown in a phylogenetic tree to provide context for how sequences are genetically related. Closely related sequences may be consistent with shared transmission history, but genomics alone cannot establish direct transmission pathways. For more information on how to interpret phylogenetic trees like the one below, see the Applied Genomic Epidemiology Handbook section on phylogenetic trees.

Explore the full Nextstrain build using the Bedford Lab North American measles tree. We gratefully acknowledge the Bedford Lab for creating and maintaining the build embedded here, as well as nextstrain.org.

Global genomic surveillance context

Explore the global measles sequence dashboard

Worldwide PathoPlexus sequence records, geography, and genotype trends.

U.S. measles surveillance dashboard

Annual confirmed cases by state

Measles cases in 2025 and 2026 are elevated over previous years

Measles cases have spread to all regions of the US over the past three years

US sequences over time by genotype

Most common reported genotypes

Top 10 submitting organizations

Submitting authors

Submitting authors

Submitting authors

Submitting authors

Submitting authors

Submitting authors

Submitting authors

Submitting authors

Submitting authors

US sequences by collection year and reported state

Reported measles genotypes by state over time

North American measles virus tree

Explore the global measles sequence dashboard